PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00927.1.g00080.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 371aa    MW: 40185.3 Da    PI: 8.3983
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00927.1.g00080.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF58.96.5e-19128172145
                                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
                        SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45 
                                   kri ++ +rqv fskR+ g++KKA+ LS LC+a vav+ fs+ gk
  Zpz_sc00927.1.g00080.1.am.mk 128 KRIASEEKRQVCFSKRKDGLFKKASDLSALCGAHVAVVAFSPGGK 172
                                   79****************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.193120180IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-29120179IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.1E-26120191IPR002100Transcription factor, MADS-box
CDDcd002651.00E-32121196No hitNo description
PRINTSPR004043.1E-17122142IPR002100Transcription factor, MADS-box
PfamPF003199.5E-24129176IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-17142157IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-17157178IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MVKSEEGQSW AGATRRKTMM AMSHPSHACI VPITKSLEFV LINQSNSQKI FLIPAIHFHA  60
CVSPVLYKHS KPPAAAHSLS LERYYLSLHL DMASRDHSDV SLEAAPAAVM TIGRKRKKTM  120
GRQKIEIKRI ASEEKRQVCF SKRKDGLFKK ASDLSALCGA HVAVVAFSPG GKPFSFGHPS  180
VDALVGRFTD PAAPGAMGPA PVHSALLEEF SREEEFLAKA LAAEASRKKA LEAAICQAGV  240
WTGDADVKSA SPNDVLAMRS ALERVHAEVA ERLQEFMAEE AMMQLTASAG LFVADGGVSS  300
HHRDQVVMDE QKMVAMGGNV DHALPFAAMM LPLPPYDHCF DLNHGPHTIL QPGRRANYDQ  360
PMSSSPAASK L
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113117RKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002451595.18e-51hypothetical protein SORBIDRAFT_04g004410
TrEMBLC5XVH49e-51C5XVH4_SORBI; Putative uncharacterized protein Sb04g004410
STRINGSb04g004410.12e-50(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP133092432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-25AGAMOUS-like 62